SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357507 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000357507
Domain Number - Region: 131-227
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 0.00425
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357507   Gene: ENSG00000143612   Transcript: ENST00000368521
Sequence length 253
Comment pep:known chromosome:GRCh38:1:154206706:154220606:-1 gene:ENSG00000143612 transcript:ENST00000368521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE
EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE
GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ
EALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK
SFKDNYNTLESTL
Download sequence
Identical sequences G3S4N8 I6L538 Q9BWL3
ENSPPYP00000000916 ENSP00000357507 HR2432 ENSPPYP00000000916 gi|148833486|ref|NP_001092086.1| ENSP00000357507 NP_001092086.1.87134 NP_001092086.1.92137 XP_004026828.1.27298 XP_009241861.1.23681 ENSGGOP00000023041 9600.ENSPPYP00000000916 9606.ENSP00000357507 ENSGGOP00000023041 ENSP00000354496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]