SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357798 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357798
Domain Number 1 Region: 351-542
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.97e-42
Family Hemopexin-like domain 0.00038
Further Details:      
 
Domain Number 2 Region: 172-327
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.81e-34
Family Matrix metalloproteases, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 43-122
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000188
Family MMP N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357798   Gene: ENSG00000154485   Transcript: ENST00000368808
Sequence length 569
Comment pep:known chromosome:GRCh38:10:125766453:125775821:-1 gene:ENSG00000154485 transcript:ENST00000368808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRY
GWSGVWAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVP
DMRPPPPSAPPSPPGPPPRARSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRL
LGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFGRGRHLGCPR
AFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSI
MQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFR
NSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYD
SDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNR
VLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSW
LPANGLFPKKFISEKWFDVCDVHISTLNM
Download sequence
Identical sequences Q8N119
ENSP00000357798 ENSP00000357798 9606.ENSP00000357798 ENSP00000357798 NP_671724.1.87134 NP_671724.1.92137 gi|22218341|ref|NP_671724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]