SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357804 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357804
Domain Number 1 Region: 45-231
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 4.09e-41
Family PaaI/YdiI-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357804   Gene: ENSG00000159445   Transcript: ENST00000368814
Sequence length 240
Comment pep:known chromosome:GRCh38:1:151873584:151909808:-1 gene:ENSG00000159445 transcript:ENST00000368814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLG
FEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANL
NINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
Download sequence
Identical sequences Q5T1C6
gi|76159293|ref|NP_444283.2| 9606.ENSP00000357804 ENSP00000357804 NP_444283.2.87134 NP_444283.2.92137 HR5707 ENSP00000357804 ENSP00000357804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]