SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357904 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357904
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357904   Gene: ENSG00000163155   Transcript: ENST00000368908
Sequence length 227
Comment pep:known chromosome:GRCh38:1:151159748:151165919:-1 gene:ENSG00000163155 transcript:ENST00000368908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHS
TERKKQETGAGRANGEVLPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
NGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences Q96S90
ENSP00000357904 ENSP00000357904 9606.ENSP00000357904 NP_997716.1.87134 NP_997716.1.92137 XP_008968675.1.60992 ENSP00000357904 gi|47086487|ref|NP_997716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]