SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000357906 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000357906
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0209
Family Molybdopterin synthase subunit MoaE 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357906   Gene: ENSG00000163154   Transcript: ENST00000368910
Sequence length 184
Comment pep:known chromosome:GRCh38:1:151156629:151159749:1 gene:ENSG00000163154 transcript:ENST00000368910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences Q6P589
ENSP00000357906 ENSP00000357906 NP_078851.2.87134 NP_078851.2.92137 ENSP00000357906 9606.ENSP00000357906 gi|157389001|ref|NP_078851.2| GO.35205 HR2285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]