SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358463 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358463
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.09e-52
Family Nicotinic receptor ligand binding domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 195-391
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.31e-49
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358463   Gene: ENSG00000146276   Transcript: ENST00000369451
Sequence length 392
Comment pep:putative chromosome:GRCh38:6:89178599:89231278:-1 gene:ENSG00000146276 transcript:ENST00000369451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPSTNNLSMTFDG
RLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFSRFPL
DTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTDERISLSQFLIQEFHTTTKLAFYSSTGW
YNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTI
ITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKEQKLREKLPCTS
GLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKPDRMMVQLTLASERSSPQRKSQRSSYVS
MRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
Download sequence
Identical sequences ENSP00000358463 NP_001243633.1.87134 NP_001243633.1.92137 NP_001254511.1.87134 NP_001254511.1.92137 XP_016866178.1.92137 ENSP00000358463 ENSP00000478846 ENSP00000481986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]