SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000358529 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358529
Domain Number 1 Region: 110-185
Classification Level Classification E-value
Superfamily Tetraspanin 0.00000000000432
Family Tetraspanin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358529   Gene: ENSG00000134198   Transcript: ENST00000369516
Sequence length 221
Comment pep:known chromosome:GRCh38:1:115048011:115089464:-1 gene:ENSG00000134198 transcript:ENST00000369516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLY
VLVGAGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHV
QTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIET
IISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI
Download sequence
Identical sequences A0A096NCJ5 A0A0D9S658 A0A2K5WXL2 A0A2K6MFQ2 A0A2K6PNU3 F7HA08 G1QYJ8 K7B995 O60636
ENSMMUP00000022934 ENSPANP00000010542 ENSP00000358529 9544.ENSMMUP00000039337 9606.ENSP00000358529 ENSMMUP00000039337 ENSNLEP00000006019 ENSP00000358527 NP_005716.2.87134 NP_005716.2.92137 XP_001111915.1.72884 XP_003268074.1.23891 XP_003805681.1.60992 XP_005542285.1.63531 XP_007975648.1.81039 XP_009427274.2.37143 XP_010370249.1.97406 XP_017725280.1.44346 ENSP00000358529 ENSNLEP00000006019 gi|21264580|ref|NP_005716.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]