SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358785 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358785
Domain Number 1 Region: 33-130
Classification Level Classification E-value
Superfamily POZ domain 1.91e-27
Family Tetramerization domain of potassium channels 0.00000207
Further Details:      
 
Domain Number 2 Region: 159-187,214-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-18
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358785   Gene: ENSG00000177301   Transcript: ENST00000369770
Sequence length 356
Comment pep:putative chromosome:GRCh38:1:110593580:110631474:-1 gene:ENSG00000177301 transcript:ENST00000369770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLER
RPLQSQKSKRGRQHLNTSHDCTLGINLVAGMTVQWTRASGPDDRQTPAVTTLHRMY
Download sequence
Identical sequences gi|324022755|ref|NP_001191198.1| ENSP00000358785 ENSP00000358785 NP_001191198.1.87134 NP_001191198.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]