SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358857 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358857
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000235
Family LEM domain 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358857   Gene: ENSG00000102119   Transcript: ENST00000369842
Sequence length 254
Comment pep:known chromosome:GRCh38:X:154379197:154381523:1 gene:ENSG00000102119 transcript:ENST00000369842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS
FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS
VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS
YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF
FIYHFMQAEEGNPF
Download sequence
Identical sequences P50402
ENSP00000358857 ENSP00000468971 gi|4557553|ref|NP_000108.1| ENSP00000358850 ENSP00000358857 9606.ENSP00000358857 NP_000108.1.87134 NP_000108.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]