SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358909 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000358909
Domain Number - Region: 106-169
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0575
Family NAD-binding domain of HMG-CoA reductase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358909   Gene: ENSG00000156398   Transcript: ENST00000369893
Sequence length 322
Comment pep:known chromosome:GRCh38:10:102714540:102743492:1 gene:ENSG00000156398 transcript:ENST00000369893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPP
GTQVEQLLYAKKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGFMLQFYRTMPAVIFWQ
WVNQSFNALVNYTNRNAASPTSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLVGRWVP
FAAVAAANCVNIPMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQVVISRITMSAPGM
ILLPVIMERLEKLHFMQKVKVLHAPLQVMLSGCFLIFMVPVACGLFPQKCELPVSYLEPK
LQDTIKAKYGELEPYVYFNKGL
Download sequence
Identical sequences G3R1U1 Q96NB2
NP_849189.1.87134 NP_849189.1.92137 XP_004050074.1.27298 XP_011537564.1.92137 ENSP00000358909 gi|30578418|ref|NP_849189.1| ENSP00000358909 9606.ENSP00000358909 ENSP00000358909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]