SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359219 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359219
Domain Number 1 Region: 172-270
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 52-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000143
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 124-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000069
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359219   Gene: ENSG00000107821   Transcript: ENST00000370200
Sequence length 304
Comment pep:known chromosome:GRCh38:10:101061841:101065592:1 gene:ENSG00000107821 transcript:ENST00000370200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPPRPAAALALPVLLLLLVVLTPPPTGARPSPGPDYLRRGWMRLLAEGEGCAPCRPEE
CAAPRGCLAGRVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGE
VPEPLCACRSQSPLCGSDGHTYSQICRLQEAARARPDANLTVAHPGPCESGPQIVSHPYD
TWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQI
QAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEEEAESEEN
DDYY
Download sequence
Identical sequences Q96I82
9606.ENSP00000359219 ENSP00000359219 NYSGRC-IgSF-KAZD1_HUMAN ENSP00000359219 NP_112191.2.87134 NP_112191.2.92137 XP_016872203.1.92137 XP_016872204.1.92137 gi|19923632|ref|NP_112191.2| ENSP00000359219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]