SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359656 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359656
Domain Number 1 Region: 79-277
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-47
Family DBL homology domain (DH-domain) 0.0000000924
Further Details:      
 
Domain Number 2 Region: 270-393
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-36
Family Pleckstrin-homology domain (PH domain) 0.00000126
Further Details:      
 
Domain Number 3 Region: 9-78
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-24
Family SH3-domain 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359656   Gene: ENSG00000129675   Transcript: ENST00000370622
Sequence length 622
Comment pep:known chromosome:GRCh38:X:136665547:136768627:-1 gene:ENSG00000129675 transcript:ENST00000370622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYV
REIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSN
NNLSTVEVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAY
CANHPSAVNVLTQHSDELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHM
EDTHPDHQDILKAIVAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMS
QVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDC
TFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTG
QPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRK
TERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEE
KLIIEETRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVR
RLLKQTDECIRGESSSKTSILP
Download sequence
Identical sequences ENSP00000359654 ENSP00000359656 ENSP00000359654 ENSP00000359656 NP_001293106.1.87134 NP_001293106.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]