SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359691 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359691
Domain Number 1 Region: 183-507
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-64
Family Glutamine synthetase catalytic domain 0.00047
Further Details:      
 
Domain Number 2 Region: 73-179
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 3.01e-20
Family Glutamine synthetase, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359691   Gene: ENSG00000146166   Transcript: ENST00000370657
Sequence length 509
Comment pep:known chromosome:GRCh38:6:63279636:63319977:-1 gene:ENSG00000146166 transcript:ENST00000370657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDS
SQILTPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMP
RGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPL
LTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQPFM
QELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIA
SFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMA
PSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETF
IRYFVAMKKYELENEEIAAERNKFLEYFI
Download sequence
Identical sequences Q5TDP6
NP_057655.2.87134 NP_057655.2.92137 ENSP00000359691 ENSP00000359691 gi|221307485|ref|NP_057655.2| 9606.ENSP00000359691 ENSP00000359691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]