SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359790 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359790
Domain Number 1 Region: 155-429
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-86
Family Calponin-homology domain, CH-domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 4634-4793
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 4462-4577
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 4855-5010
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 445-561
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 3975-4134
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 4216-4356
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 3432-3589
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 4306-4456
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-23
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 5006-5121
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 2195-2353
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-21
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 2996-3150
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 5368-5450
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.19e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 14 Region: 5071-5198,5228-5259
Classification Level Classification E-value
Superfamily Spectrin repeat 5.44e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 2663-2788
Classification Level Classification E-value
Superfamily Spectrin repeat 7.35e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 16 Region: 3868-4015
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 17 Region: 3209-3369
Classification Level Classification E-value
Superfamily Spectrin repeat 1.6e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 18 Region: 1414-1542,1569-1597
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 19 Region: 879-981
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 20 Region: 3585-3701
Classification Level Classification E-value
Superfamily Spectrin repeat 6.33e-16
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 5279-5359
Classification Level Classification E-value
Superfamily EF-hand 7.7e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 2884-3006
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000302
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 3650-3798
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000523
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 24 Region: 4131-4245
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 1966-2087
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 26 Region: 2103-2209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000863
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 27 Region: 2795-2897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000705
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 28 Region: 2412-2532
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000122
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2571-2680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000225
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 786-878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000406
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 31 Region: 954-1061,1182-1203
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000023
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000359790
Domain Number - Region: 1733-1845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1199-1349
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00785
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359790   Gene: ENSG00000151914   Transcript: ENST00000370754
Sequence length 5675
Comment pep:known chromosome:GRCh38:6:56457989:56954628:-1 gene:ENSG00000151914 transcript:ENST00000370754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRKLQKGRHPMKSVFSGRSRSR
DAVLRSHHFRSEGFRASPRHLRRRVAAAAAARLEEVKPVVEVHHQSEQETSVRKRRIKKS
SRVQPEFYHSVQGASIRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYED
LRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGN
PKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRD
GKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKS
VITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFPNN
PVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEW
GKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGV
QFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSS
VYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSG
MTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEE
INMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISE
IQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEE
VAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAA
MQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHK
LEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE
ITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNV
LTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLED
SQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENC
EDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSS
VPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVI
ADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKE
KADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPE
NSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKS
PVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEH
VEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKH
GDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYKEK
LQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTE
NFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAA
VKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNG
NLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPE
EKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELEN
LEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTS
ATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATAS
KHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQ
KTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPL
NSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFS
EASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQE
STSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVT
SCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEI
QKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMT
DISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDT
EAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQE
LNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQV
QILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRC
DWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQ
EKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASS
HQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIA
EGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLW
PWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEID
KEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIH
DSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETI
AQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQ
KQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDR
AQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQ
KEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQ
EALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKST
VEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHE
TLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSL
KVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNE
VHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLI
IQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQ
VLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNER
YRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQL
QVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSER
YLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIA
EHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQST
QFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQR
GEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHM
SLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAA
CGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGG
KLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQ
DPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGG
DPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQ
NVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNV
HMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKT
KLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSH
REQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQ
FHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTG
RSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALID
WLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDD
SSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFH
GVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITII
RARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEE
VKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASS
LYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWR
KKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRD
GDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFF
LGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILAD
GASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYG
KPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAA
ARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHR
PTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences NP_001138241.1.87134 NP_001138241.1.92137 ENSP00000359790 9606.ENSP00000359790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]