SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359824 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359824
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-85
Family Calponin-homology domain, CH-domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 4347-4506
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 4568-4723
Classification Level Classification E-value
Superfamily Spectrin repeat 5.49e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 4180-4290
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 3688-3847
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-25
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 3929-4069
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 3254-3411
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 2485-2634
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-22
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 10 Region: 4719-4834
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 2017-2175
Classification Level Classification E-value
Superfamily Spectrin repeat 8.8e-21
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 2818-2972
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 5081-5160
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.58e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 14 Region: 3406-3523
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 15 Region: 4784-4911,4941-4972
Classification Level Classification E-value
Superfamily Spectrin repeat 6.16e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 16 Region: 4062-4180
Classification Level Classification E-value
Superfamily Spectrin repeat 9.07e-19
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 17 Region: 3581-3728
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 3031-3191
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 19 Region: 1236-1364,1391-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 2.8e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 20 Region: 701-803
Classification Level Classification E-value
Superfamily Spectrin repeat 4.61e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 21 Region: 4992-5072
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000104
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 2706-2828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 3846-3958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000288
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 24 Region: 1788-1909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000151
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 25 Region: 1925-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000791
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 26 Region: 2617-2719
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000461
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 27 Region: 2234-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000111
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 2393-2501
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000379
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 608-700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000038
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 30 Region: 776-883,1004-1025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000849
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000359824
Domain Number - Region: 1555-1667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1021-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00327
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359824   Gene: ENSG00000151914   Transcript: ENST00000370788
Sequence length 5375
Comment pep:novel chromosome:GRCh38:6:56457996:56843665:-1 gene:ENSG00000151914 transcript:ENST00000370788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYK
EKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKV
AAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEV
NGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQEL
ENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVD
TSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKND
IQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQV
PLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYM
QESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEA
VTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKD
MTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPT
DTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQ
QVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSD
RCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACA
SSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKT
IAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCE
IDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLD
IHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAET
LQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLL
DRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQ
LQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRK
STVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKVLQEDILLRKQNVDQALLNGL
ELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWL
DKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAR
EGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLG
DIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVL
KNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQ
QQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKK
RAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDM
EKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLD
VMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEEL
DIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDG
LQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLL
KKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTH
TEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASN
LQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPL
GGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEK
WESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQI
DEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVER
GRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLG
AKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLF
SGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALK
RSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALL
EWLAEAEQTLRFHGVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHP
DSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLT
DKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLD
KGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEE
LREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSR
LEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRF
QVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHH
GSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGA
SPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAA
ARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHR
PTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences ENSP00000359824 ENSP00000359824 XP_016866713.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]