SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000359908 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359908
Domain Number 1 Region: 7-158
Classification Level Classification E-value
Superfamily GroES-like 1.2e-40
Family Alcohol dehydrogenase-like, N-terminal domain 0.000000655
Further Details:      
 
Domain Number 2 Region: 121-255
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.83e-30
Family Alcohol dehydrogenase-like, C-terminal domain 0.000000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359908   Gene: ENSG00000116791   Transcript: ENST00000370871
Sequence length 295
Comment pep:known chromosome:GRCh38:1:74705972:74733022:-1 gene:ENSG00000116791 transcript:ENST00000370871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS
RKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEK
LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA
GTEEGQKIVLQNGAHEVFNHREVNYIDKIKVVGSRGTIEINPRDTMAKESSIIGVTLFSS
TKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Download sequence
Identical sequences ENSP00000359908 ENSP00000359908 NP_001123515.1.87134 NP_001123515.1.92137 XP_016855856.1.92137 gi|194239676|ref|NP_001123515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]