SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360121 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360121
Domain Number 1 Region: 311-392
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 2 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000360121
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00112
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360121   Gene: ENSG00000185483   Transcript: ENST00000371080
Sequence length 393
Comment pep:known chromosome:GRCh38:1:63774022:64143385:1 gene:ENSG00000185483 transcript:ENST00000371080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Download sequence
Identical sequences K7DE05
gi|134152686|ref|NP_001077061.1| ENSP00000360121 NP_001077061.1.87134 NP_001077061.1.92137 ENSP00000360121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]