SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360265 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360265
Domain Number 1 Region: 361-767
Classification Level Classification E-value
Superfamily ALDH-like 1.3e-90
Family ALDH-like 0.000000129
Further Details:      
 
Domain Number 2 Region: 71-351
Classification Level Classification E-value
Superfamily Carbamate kinase-like 2.88e-51
Family PyrH-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360265   Gene: ENSG00000059573   Transcript: ENST00000371221
Sequence length 793
Comment pep:known chromosome:GRCh38:10:95605945:95656706:-1 gene:ENSG00000059573 transcript:ENST00000371221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVYRCGFQPFNQHLLPWVKCTTVFRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVIS
VKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSR
VGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPT
VEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPL
LKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFES
RPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEV
EDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVR
DSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVK
SLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVDSACVFWN
ASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKY
LHENLPIPQRNTN
Download sequence
Identical sequences K7CWH4
ENSP00000360265 gi|62912457|ref|NP_001017423.1| NP_001017423.1.87134 NP_001017423.1.92137 NP_001310344.1.87134 NP_001310344.1.92137 XP_003825442.1.60992 XP_016774448.1.37143 XP_016774449.1.37143 ENSP00000360265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]