SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360271 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360271
Domain Number 1 Region: 736-815
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-20
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1206-1264
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 817-904
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-18
Family SH3-domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSP00000360271
Domain Number - Region: 175-208
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0837
Family Iron-containing alcohol dehydrogenase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360271   Gene: ENSG00000095637   Transcript: ENST00000371227
Sequence length 1266
Comment pep:novel chromosome:GRCh38:10:95311771:95561378:-1 gene:ENSG00000095637 transcript:ENST00000371227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
LTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAK
DDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDDDSDLYSPRYSF
SEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTR
KYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWD
YTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEIS
SETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSA
STKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIP
THHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQI
DQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEM
SFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSP
SRSATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPP
LPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAP
TSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQ
YERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFP
GSEAEQTERHRGGEQAGRKAARRGGSQLSHHSLRAGPDLTESEKSYVQPQAQQRRVTPDR
SQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNY
VKPLYL
Download sequence
Identical sequences ENSP00000360271 ENSP00000360271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]