SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360295 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360295
Domain Number 1 Region: 572-644
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-20
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 735-814
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-20
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 645-737
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-18
Family SH3-domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSP00000360295
Domain Number - Region: 143-176
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0488
Family Iron-containing alcohol dehydrogenase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360295   Gene: ENSG00000095637   Transcript: ENST00000371249
Sequence length 816
Comment pep:known chromosome:GRCh38:10:95311773:95561378:-1 gene:ENSG00000095637 transcript:ENST00000371249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSECDGGSKAVMNGLAPGSNGQDKDMDLTKICTGKGAVTLRASSSYRETPSSSPASPQE
TRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSS
SAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIP
PHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDS
SPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVS
ERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSK
DWYKTMFKQIHKLNRDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATL
PLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSSAISPT
PEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRP
SSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEMRPARAKFDFKAQTLKELPLQKGD
IVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNF
NGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYM
DLPFSSSPSRSATASPQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGD
IVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
Download sequence
Identical sequences ENSP00000360295 ENSP00000360295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]