SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000360818 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000360818
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily POZ domain 6.28e-29
Family BTB/POZ domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000360818   Gene: ENSG00000148411   Transcript: ENST00000371753
Sequence length 587
Comment pep:known chromosome:GRCh38:9:136006537:136050580:-1 gene:ENSG00000148411 transcript:ENST00000371753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFS
GNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLM
FKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMP
YPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKP
EPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQ
LMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLD
PEFPPAAAQVFEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQ
EVAAPEPLPADGQSPPQPFEQGGGGPSRPQTPAAAARRPEGTYAGTL
Download sequence
Identical sequences A0A024R8I0 Q96BF6
NP_653254.1.87134 NP_653254.1.92137 XP_011516523.1.92137 9606.ENSP00000277554 ENSP00000277554 ENSP00000277554 ENSP00000360818 gi|21389533|ref|NP_653254.1| ENSP00000277554 ENSP00000360818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]