SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361182 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361182
Domain Number 1 Region: 80-301
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.61e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 346-485
Classification Level Classification E-value
Superfamily Nudix 1.04e-29
Family MutY C-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361182   Gene: ENSG00000132781   Transcript: ENST00000372110
Sequence length 536
Comment pep:known chromosome:GRCh38:1:45329242:45340388:-1 gene:ENSG00000132781 transcript:ENST00000372110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDAGLARQPE
EVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVS
EVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKV
VEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADP
SSTLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVE
QEQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSA
TCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPA
THLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKV
FRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
Download sequence
Identical sequences NP_001280119.1.87134 NP_001280119.1.92137 ENSP00000361182 ENSP00000361182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]