SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361187 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361187
Domain Number 1 Region: 79-300
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.61e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 345-484
Classification Level Classification E-value
Superfamily Nudix 1.04e-29
Family MutY C-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361187   Gene: ENSG00000132781   Transcript: ENST00000372115
Sequence length 535
Comment pep:known chromosome:GRCh38:1:45329242:45340470:-1 gene:ENSG00000132781 transcript:ENST00000372115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGLARQPEE
VVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSE
VMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVV
EELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPS
STLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQ
EQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSAT
CVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPAT
HLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVF
RVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
Download sequence
Identical sequences E5KP27
ENSP00000361187 NP_001041636.1.87134 NP_001041636.1.92137 gi|115298648|ref|NP_001041636.1| GO.38537 ENSP00000361187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]