SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361304 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000361304
Domain Number - Region: 240-314
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000314
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 
Domain Number - Region: 75-158
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0811
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361304   Gene: ENSG00000080189   Transcript: ENST00000372230
Sequence length 365
Comment pep:known chromosome:GRCh38:20:46349528:46364395:-1 gene:ENSG00000080189 transcript:ENST00000372230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFS
ALSRALVQCSSHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSA
VLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRW
TLTQMLLQKAELGLQNPIDTMFHLQPLMFLGLFPLFAVFEGLHLSTSEKIFRFQDTGLLL
RVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNW
LGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFV
AQGQQ
Download sequence
Identical sequences H2QKI3 Q9NQQ7
ENSP00000243896 ENSP00000361301 ENSP00000361304 ENSPTRP00000023344 NP_001268389.1.87134 NP_001268389.1.92137 NP_057029.8.87134 NP_057029.8.92137 NP_775271.1.87134 NP_775271.1.92137 XP_008949637.1.60992 XP_008949638.1.60992 XP_009435485.1.37143 XP_009435486.1.37143 XP_009435487.1.37143 XP_011527133.1.92137 XP_011527134.1.92137 XP_011527135.1.92137 XP_016792655.1.37143 XP_016883345.1.92137 XP_016883346.1.92137 XP_016883347.1.92137 XP_016883348.1.92137 XP_016883349.1.92137 ENSP00000243896 ENSP00000361301 ENSP00000361304 gi|21314776|ref|NP_057029.8| gi|27881499|ref|NP_775271.1| ENSPTRP00000023344 9598.ENSPTRP00000023344 9606.ENSP00000243896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]