SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361405 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361405
Domain Number 1 Region: 513-706
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.42e-57
Family Hemopexin-like domain 0.00000000327
Further Details:      
 
Domain Number 2 Region: 114-213,387-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.27e-42
Family Matrix metalloproteases, catalytic domain 0.000000259
Further Details:      
 
Domain Number 3 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 2.8e-21
Family Fibronectin type II module 0.0000846
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000604
Further Details:      
 
Domain Number 5 Region: 219-273
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000665
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 4.24e-18
Family MMP N-terminal domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361405   Gene: ENSG00000100985   Transcript: ENST00000372330
Sequence length 707
Comment pep:known chromosome:GRCh38:20:46008908:46016561:1 gene:ENSG00000100985 transcript:ENST00000372330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences P14780
ENSP00000361405 gi|74272287|ref|NP_004985.2| NP_004985.2.87134 NP_004985.2.92137 9606.ENSP00000361405 ENSP00000361405 ENSP00000361405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]