SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361771 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361771
Domain Number 1 Region: 5-209
Classification Level Classification E-value
Superfamily NAP-like 4.58e-79
Family NAP-like 0.00000000292
Further Details:      
 
Weak hits

Sequence:  ENSP00000361771
Domain Number - Region: 216-256
Classification Level Classification E-value
Superfamily ARM repeat 0.0806
Family GUN4-associated domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361771   Gene: ENSG00000119335   Transcript: ENST00000372686
Sequence length 265
Comment pep:putative chromosome:GRCh38:9:128689989:128694894:1 gene:ENSG00000119335 transcript:ENST00000372686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSHQPPPPPHEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRS
ELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENP
YFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTW
FTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEG
DEDEGEEDEDDDEGEEGEEDEGEDD
Download sequence
Identical sequences A0A2J8NB92 A0A2J8UJT1
ENSP00000361771 ENSP00000361771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]