SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000361850 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361850
Domain Number 1 Region: 166-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-81
Family Eukaryotic proteases 0.000000000629
Further Details:      
 
Domain Number 2 Region: 48-161
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-33
Family Kringle modules 0.0000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361850   Gene: ENSG00000122861   Transcript: ENST00000372764
Sequence length 431
Comment pep:known chromosome:GRCh38:10:73911157:73917497:1 gene:ENSG00000122861 transcript:ENST00000372764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Download sequence
Identical sequences XP_011538168.1.92137 ENSP00000361850 ENSP00000361847 9606.ENSP00000361850 ENSP00000361850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]