SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362006 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362006
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.92e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 1511-1735
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-53
Family Plakin repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 1739-1917
Classification Level Classification E-value
Superfamily Plakin repeat 1.24e-49
Family Plakin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 2367-2565
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-43
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 6607-6758
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-28
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 6222-6330
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 2659-2770
Classification Level Classification E-value
Superfamily Plakin repeat 1.07e-24
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 8 Region: 5401-5547
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-24
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 10 Region: 7120-7196
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.7e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 11 Region: 4855-5012
Classification Level Classification E-value
Superfamily Spectrin repeat 6.43e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 12 Region: 6760-6877
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 6410-6548
Classification Level Classification E-value
Superfamily Spectrin repeat 7.32e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 6107-6221
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 15 Region: 5727-5885
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-21
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 16 Region: 5290-5413
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-21
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 17 Region: 6826-6953,6980-7011
Classification Level Classification E-value
Superfamily Spectrin repeat 1.69e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 18 Region: 5969-6110
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 5510-5666
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 3967-4096
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 21 Region: 2549-2654
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-16
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 6326-6442
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 1227-1353,1380-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 24 Region: 7031-7111
Classification Level Classification E-value
Superfamily EF-hand 9.96e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 5069-5229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000237
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 26 Region: 4522-4646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000384
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 27 Region: 4745-4866
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000864
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 28 Region: 3831-3954
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000336
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 29 Region: 4430-4534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000236
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 682-784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000624
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 31 Region: 4296-4395
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000824
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 32 Region: 4077-4206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 33 Region: 5889-5996
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000633
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 34 Region: 591-680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000955
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 35 Region: 4169-4289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000275
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 36 Region: 2287-2364
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000105
Family Plakin repeat 0.0019
Further Details:      
 
Domain Number 37 Region: 3611-3728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 38 Region: 4654-4762
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000016
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 39 Region: 3443-3597
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000149
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 40 Region: 1424-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000362006
Domain Number - Region: 789-862
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0148
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 5204-5282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.023
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362006   Gene: ENSG00000127603   Transcript: ENST00000372915
Sequence length 7388
Comment pep:novel chromosome:GRCh38:1:39084132:39486980:1 gene:ENSG00000127603 transcript:ENST00000372915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISW
NYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEE
EVEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTD
RDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTL
RHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVST
LARNTQGKATSSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EKEKKQISEQLNALNKAYHDLCDGSANQLQQLQSQLAHQTEQKECRAVAGVIDLGTVEIF
PIFKAMQKGLLDQDTGLVLLESQVIMSGLIAPETGENLSLEEGIARNLINPQMYQQLREL
QDALALISRLTESRGPLSVVEAIEKRIISETVGLKILEAHLATGGFSLSPSENCINLEEA
FHQGLISAWLHSVLESYLRTSKNLIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAG
GMVSLKSGRKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLI
DQDMACAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPE
SGEILPITDALEQGIVSTELAHKILSNRQHIKALFLPATTEILSWKKAIESGILDRDLAN
NLKSICIPDVMPHMQLADSAEQNINPGAAVLPCSKSHPKATASQSENLLFQLMTHSYINV
QNGQRLLLLDKELMETLTSRDEYQTSPPKVVEIGHQRQKTPEGLQESANVKISGTFSSGW
TVRLPEFQFSSQNKEYPDREDCTTEKGKKTTVETEDSSVENPEQDLFVEQKERNPNIDAL
KVINKVKLEVQRQLIGTQREDQTAVSVRENASRGHLLTIPPAEAEGVPLVVDKDVFSVET
PKKEHQPLRNTSFTCQNEQAHTLETEYIHDETGGSHIKPQSKKLQVQVKKTLGIKLELKS
ETDGNVHPLDKKEMLKKTFLAKDDHKESQEAQNIAGGSMMMSEKTDEEDSGREIFLSCSH
PLELLEEATLNVLSAQLLDGGIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKLNMFQGF
FDSQTCESLTTEEVINEGLMDEKLLHNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDK
ETATRILERQVVTGGIIDLKRGKKVSVTLASTLGLVDVADQPELINLEKASKGRDAEKTV
RERLISLQMETTGLIDPDSKAPLTVVQSIDRGLLEREEAVRLLTKQVVDGGIIHHISGMR
LSVDNAFRHGLIGEDLAEKLKRVENLNIHQIFNPETKENISLPKAIKLDLITSDLKREIQ
EVQAFTGNFVDLISGQRLTLAEAKKEGLLTNEAVLSPGMMHGIVDPENCRIVPYSELVKK
CKIDIESGQRYLEVIPFSDIKDGVSDKVLTLSQAIQLGKVDFASTLKVLEAQANTGGIID
TATGKRLTLASALEEKLVDENMVRIIASHQVLNGGIVDIFSDQRVTLVEAIEKRLISPEL
ANMIQIDSSEFSDHRAQIEKQEGIEVCALQNEFLGKDMLIACNQTAEMSCNKVEESERLF
QVENQSAQEKVKVRVSDGEQAKKSREISLKEFGCKDQRKPRMSSDAKEFISIINPHNLKG
KSLGQVSLTHPYSECDFKLKEVARNNMGNDTNEEQEKAVTKIEIISHMKQSTSCLDSEEI
RENQGEVILEVQETYCETSGKLPSEQVLQQPMNARVKSKREKREVIVEESIRTCKPAFLS
EEKLYQETAIRDEHDSHIKSQPREMTSSEKGKEADTEMGFSITFKIEESSSQVVPQGISV
KHLDALTLFSSKQANEGKVNNLSLCLTLKPEENLSREIACGAQSEPFPCMTPRPEGLHYQ
ESDGKAQVTGPSQISKTDKSFQGTTRQETNYQDSWVTSKTKETKHQISSSNECKEKSYQE
VSFDPARGLKLEEITVSRPDSKEVRYLEFSDRKDLHHQGSKSDDKLCGTLKSEIATQELT
GEKFLEMANPNVAGLEAGSIEDIVTQRGSRVLGSFLPEKLFKGVSQKENTGQQNAIISPT
VLETSEEKTVSLTVCSAVKTEKTPQEKLRESPGSEQTPFMTAPEGKGNGGVNPEPFRATQ
NVFTRQLCLEHDEKLVSYLSLLRNIEMRTKQIQPLELNLAELQDLLCQAKVLERELKDLT
TLVSQELECVNQIIISQPQEVPAQLLKALEKDAKNLQKSLSSVSDTWNSRLLHFQNAVEI
EKTKVLNQHTQLEGRLQDLRAWVGNKNLILNSKGSNSEIDVDSLNLCLQQYEDLKQPMAE
RKAQLDALAFDIQFFISEHAQDLSPQQNRQMLRLLNELQRSFQDILEQTAAQVDALQGHL
QQMEQEALVKTLQKQQNTCHQQLEDLCSWVGQAERALAGHQGRTTQQDLSALQKNQSDLK
DLQDDIQNRATSFATVVKDIEGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVA
QKELEEAVTSALQQETEKSKAAKELAENKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLS
GASLEKGALDTTDGYMGVNQAPEKLDKQCEMMKARHQELLSQQQNFILATQSAQAFLDQH
GHNLTPEEQQMLQQKLGELKEQYSTSLAQSEAELKQVQTLQDELQKFLQDHKEFESWLER
SEKELENMHKGGSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDMENSFKEGK
EPSEIGNLVKDKLKDATERYTALHSKCTRLGSHLNMLLGQYHQFQNSADSLQAWMQACEA
NVEKLLSDTVASDPGVLQEQLATTKQLQEELAEHQVPVEKLQKVARDIMEIEGEPAPDHR
HVQETTDSILSHFQSLSYSLAERSSLLQKAIAQSQSVQESLESLLQSIGEVEQNLEGKQV
SSLSSGVIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQGKLAEVSQ
RFEQLCLQQQEKESSLKKLLPQAEMFEHLSGKLQQFMENKSRMLASGNQPDQDITHFFQQ
IQELNLEMEDQQENLDTLEHLVTELSSCGFALDLCQHQDRVQNLRKDFTELQKTVKEREK
DASSCQEQLDEFRKLVRTFQKWLKETEGSIPPTETSMSAKELEKQIEHLKSLLDDWASKG
TLVEEINCKGTSLENLIMEITAPDSQGKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMS
DVNLKYEKLGGVLHERQESLQAILNRMEEVHKEANSVLQWLESKEEVLKSMDAMSSPTKT
ETVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEELNSRWER
ATEVTVARQRQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQV
QFMLKEFEARRQQHEQLNEAAQGILTGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRS
SQIDQAIVKSTQYQELLQDLSEKVRAVGQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQ
LDHEVKEAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRINRLQAALAST
QQFQQMFDELRTWLDDKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVA
EGESLLLSVPPGEEKRTLQNQLVELKNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDL
VPWIEDCKAKMSELRVTLDPVQLESSLLRSKAMLNEVEKRRSLLEILNSAADILINSSEA
DEDGIRDEKAGINQNMDAVTEELQAKTGSLEEMTQRLREFQESFKNIEKKVEGAKHQLEI
FDALGSQACSNKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEV
AQQEFLEVKQRVNSGCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSL
QSQIEDVRLFLNKIHVLKLDIEASEAECRHMLEEEGTLDLLGLKRELEALNKQCGKLTER
GKARQEQLELTLGRVEDFYRKLKGLNDATTAAEEAEALQWVVGTEVEIINQQLADFKMFQ
KEQVDPLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQ
EALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKAT
VDMLQAEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHE
TAEPISDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALNEEIVNRKKNVDQAIKNGQAL
LKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLRE
VEEELATSGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREG
LDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPI
RLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVLQEKTESLIQQ
YEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQ
EEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMVEEKYQKAENMYAQIKEEVRQRA
LALDEAVSQSTQITEFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVE
LEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFL
DVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEE
LEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQD
TLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELM
LKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLT
HTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDAS
SLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKP
TGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLE
QKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLS
QIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSI
ERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKT
LGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEAL
LFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQV
LKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHM
LLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVC
HPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETT
LIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKS
RSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEEL
KEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKL
EMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQ
VEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELRE
KFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTK
VIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRA
GSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTAS
PRTPGPKR
Download sequence
Identical sequences Q9UPN3
ENSP00000362006 ENSP00000362006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]