SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362016 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362016
Domain Number 1 Region: 3653-3810
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 2336-2496
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-28
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 3217-3361
Classification Level Classification E-value
Superfamily Spectrin repeat 2.21e-28
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 2447-2603
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 4166-4242
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.68e-24
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 6 Region: 1901-2058
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 3456-3594
Classification Level Classification E-value
Superfamily Spectrin repeat 3.72e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 3808-3923
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 9 Region: 2773-2931
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-21
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 3116-3230
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-19
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 11 Region: 2556-2712
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 1034-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 13 Region: 3339-3446
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 14 Region: 361-487,514-540
Classification Level Classification E-value
Superfamily Spectrin repeat 4.85e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 4077-4157
Classification Level Classification E-value
Superfamily EF-hand 5.69e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 16 Region: 2115-2275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000136
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 17 Region: 1568-1692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000222
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 18 Region: 1791-1912
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000464
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 19 Region: 898-1021
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 20 Region: 1474-1580
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000851
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 21 Region: 1362-1462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000051
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 22 Region: 1144-1283
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 23 Region: 3931-4003,4031-4060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000027
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 24 Region: 3015-3118
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000247
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 25 Region: 2935-3042
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000036
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 26 Region: 636-793
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000929
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 27 Region: 1700-1801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000234
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 28 Region: 558-674
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000105
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000362016
Domain Number - Region: 1293-1396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000446
Family Spectrin repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362016   Gene: ENSG00000127603   Transcript: ENST00000372925
Sequence length 4434
Comment pep:novel chromosome:GRCh38:1:39300314:39486987:1 gene:ENSG00000127603 transcript:ENST00000372925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKNTISVKAVCDYRQIEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPN
KDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDLVQTWNLEKLRSSAPGEC
HQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENEDKEETVA
KMYISELKNIRLRLEEYEQRVVKRIQSLASSRTDRDAWQDNALRIAEQEHTQEDLQQLRS
DLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTVYLNKLKTVDVIVRSI
QDAELLVKGYEIKLSQEEVVLADLSALEAHWSTLRHWLSDVKDKNSVFSVLDEEIAKAKV
VAEQMSRLTPERNLDLERYQEKGSQLQERWHRVIAQLEIRQSELESIQEVLGDYRACHGT
LIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTALFAEIERNQTKLDQCQKFSQQYSTI
VKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTRYTALVTLTTQHVKYI
SDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQGKATSSETKESTDIEKAILE
QQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLSEKEKKQISEQLNALNKAYHDLCDGSA
NQLQQLQSQLAHQTEQKTLQKQQNTCHQQLEDLCSWVGQAERALAGHQGRTTQQDLSALQ
KNQSDLKDLQDDIQNRATSFATVVKDIEGFMEENQTKLSPRELTALREKLHQAKEQYEAL
QEETRVAQKELEEAVTSALQQETEKSKAAKELAENKKKIDALLDWVTSVGSSGGQLLTNL
PGMEQLSGASLEKGALDTTDGYMGVNQAPEKLDKQCEMMKARHQELLSQQQNFILATQSA
QAFLDQHGHNLTPEEQQMLQQKLGELKEQYSTSLAQSEAELKQVQTLQDELQKFLQDHKE
FESWLERSEKELENMHKGGSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDME
NSFKEGKEPSEIGNLVKDKLKDATERYTALHSKCTRLGSHLNMLLGQYHQFQNSADSLQA
WMQACEANVEKLLSDTVASDPGVLQEQLATTKQLQEELAEHQVPVEKLQKVARDIMEIEG
EPAPDHRHVQETTDSILSHFQSLSYSLAERSSLLQKAIAQSQSVQESLESLLQSIGEVEQ
NLEGKQVSSLSSGVIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQG
KLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFEHLSGKLQQFMENKSRMLASGNQPDQD
ITHFFQQIQELNLEMEDQQENLDTLEHLVTELSSCGFALDLCQHQDRVQNLRKDFTELQK
TVKEREKDASSCQEQLDEFRKLVRTFQKWLKETEGSIPPTETSMSAKELEKQIEHLKSLL
DDWASKGTLVEEINCKGTSLENLIMEITAPDSQGKTDLTEIQCDMSDVNLKYEKLGGVLH
ERQESLQAILNRMEEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKAQAESNKAFL
AELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVTVARQRQLEE
SASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQH
EQLNEAAQGILTGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQ
ELLQDLSEKVRAVGQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQTLCDE
LSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQMFDELRTWL
DDKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEE
KRTLQNQLVELKNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSEL
RVTLDPVQLESSLLRSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQ
NMDAVTEELQAKTGSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNL
EKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNS
GCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKI
HVLKLDIEASEAECRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGR
VEDFYRKLKGLNDATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQV
NGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALE
PLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQS
AELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEK
KLANSEPVGTQTAKIQQQIIRHKALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQE
KLDGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEEELATSGGQSPT
GEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKL
VSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQ
KAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYAR
LERAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHK
PHIDKLLKIGPQLKELNPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQIT
EFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEALKRR
GEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMA
ALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFA
CGETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVI
KLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIR
EPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISG
DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE
SVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDT
HMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERK
SKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNA
HRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAK
QFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRT
GRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALV
DWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRD
DTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRF
RGALPDDTEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITI
IRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNID
RVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPP
PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKK
YMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGD
GYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDS
QQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTP
FRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTP
TFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASD
FDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences H0Y390
ENSP00000362016 ENSP00000362016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]