SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362291 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362291
Domain Number 1 Region: 9-246
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.37e-61
Family MoCo biosynthesis proteins 0.000015
Further Details:      
 
Domain Number 2 Region: 386-530
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 8.63e-52
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362291   Gene: ENSG00000124615   Transcript: ENST00000373195
Sequence length 533
Comment pep:known chromosome:GRCh38:6:39905321:39934497:-1 gene:ENSG00000124615 transcript:ENST00000373195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQRLEG
LRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAI
ELGYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEM
LDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLK
VCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAELFLMFPNSPPANPSIFSWD
PLHVQGLRPRMSFSSQVATLWKGCRVPQTPPLAQQRLGSGSFQRHYTSRADSDANSKCLS
PGSWASAAPSGPQLTSEQLTHVDSEGRAAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQ
QNQLKKGDALVVAQLAGVQAAKVTSQLIPLCHHVALSHIQVQLELDSTRHAVKIQASCRA
RGPTGVEMEALTSAAVAALTLYDMCKAVSRDIVLEEIKLISKTGGQRGDFHRA
Download sequence
Identical sequences ENSP00000362291 ENSP00000362291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]