SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362329 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362329
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-108
Family Inorganic pyrophosphatase 0.0000000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362329   Gene: ENSG00000180817   Transcript: ENST00000373232
Sequence length 289
Comment pep:known chromosome:GRCh38:10:70202830:70233427:-1 gene:ENSG00000180817 transcript:ENST00000373232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGI
SCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences Q15181 V9HWB5
NP_066952.1.87134 NP_066952.1.92137 gi|11056044|ref|NP_066952.1| Hs11056044___KOG1626 hss001000516.1 hss001000516.2 ENSP00000362329 ENSP00000362329 9606.ENSP00000362329 ENSP00000362327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]