SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362384 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362384
Domain Number 1 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-43
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 2 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-28
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 537-634
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-22
Family DBL homology domain (DH-domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-21
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362384   Gene: ENSG00000006607   Transcript: ENST00000373287
Sequence length 647
Comment pep:known chromosome:GRCh38:2:241356297:241466030:1 gene:ENSG00000006607 transcript:ENST00000373287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKVFQLHEGHVAGVTKME
Download sequence
Identical sequences ENSP00000362384 ENSP00000362384 NP_001269912.1.87134 NP_001269912.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]