SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362539 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362539
Domain Number 1 Region: 94-192
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000000000228
Family Eukaryotic ODC-like 0.00057
Further Details:      
 
Domain Number 2 Region: 41-93
Classification Level Classification E-value
Superfamily PLP-binding barrel 0.000000000028
Family Alanine racemase-like, N-terminal domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362539   Gene: ENSG00000142920   Transcript: ENST00000373440
Sequence length 204
Comment pep:known chromosome:GRCh38:1:33082250:33101893:1 gene:ENSG00000142920 transcript:ENST00000373440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKIASVINSALDLYFPEGCGVDIFAELGR
YYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPT
PILQKSKNHSPCYMSLESIHFIAV
Download sequence
Identical sequences ENSP00000362539 ENSP00000351508 ENSP00000362539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]