SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362542 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362542
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.41e-66
Family Alanine racemase-like, N-terminal domain 0.0000000519
Further Details:      
 
Domain Number 2 Region: 249-420
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.42e-36
Family Eukaryotic ODC-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362542   Gene: ENSG00000142920   Transcript: ENST00000373443
Sequence length 460
Comment pep:known chromosome:GRCh38:1:33081167:33120529:1 gene:ENSG00000142920 transcript:ENST00000373443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQ
IKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSCLSLKFGVSLKSCRH
LLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFP
GTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLD
QPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPA
VDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRR
QLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences Q96A70
ENSP00000294517 ENSP00000362542 ENSP00000294517 ENSP00000362542 NP_001280491.1.87134 NP_001280491.1.92137 NP_443724.1.87134 NP_443724.1.92137 XP_005270461.1.92137 gi|16506287|ref|NP_443724.1| 9606.ENSP00000294517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]