SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362688 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362688
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-57
Family WD40-repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362688   Gene: ENSG00000084623   Transcript: ENST00000373586
Sequence length 325
Comment pep:known chromosome:GRCh38:1:32222370:32231604:1 gene:ENSG00000084623 transcript:ENST00000373586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA
Download sequence
Identical sequences A0A096NFN8 A0A0D9S7X4 A0A1S3FHS3 A0A2K5CMU1 A0A2K5Y965 A0A2K6CYX3 A0A2K6LQF6 F6QB54 G3QGU3 G8F3U1 H2N856 H9G180 K7B1S2 Q13347 Q5U0F4
ENSGGOP00000001557 ENSP00000362688 ENSP00000362688 ENSCJAP00000012629 GO.36556 HR2924 ENSP00000362688 NP_003748.1.87134 NP_003748.1.92137 XP_002750606.1.60252 XP_003828191.1.60992 XP_004025404.1.27298 XP_007977793.1.81039 XP_008576447.1.73410 XP_008999059.1.60252 XP_010352237.1.97406 XP_011761531.1.29376 XP_011829432.1.47321 XP_012296413.1.9421 XP_012876056.1.60039 XP_014989420.1.72884 XP_016073110.1.3490 XP_016813653.1.37143 XP_017712501.1.44346 ENSGGOP00000001557 9600.ENSPPYP00000001842 9606.ENSP00000362688 gi|4503513|ref|NP_003748.1| ENSPPYP00000001842 ENSPPYP00000001842 ENSPANP00000011740 ENSCJAP00000012629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]