SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000362773 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362773
Domain Number 1 Region: 62-155
Classification Level Classification E-value
Superfamily FKBP-like 7.2e-29
Family FKBP immunophilin/proline isomerase 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362773   Gene: ENSG00000102309   Transcript: ENST00000373669
Sequence length 156
Comment pep:known chromosome:GRCh38:X:72181679:72198344:1 gene:ENSG00000102309 transcript:ENST00000373669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGG
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQ
EAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences gi|38679892|ref|NP_006214.2| 9606.ENSP00000218432 ENSP00000362773 ENSP00000362773 NP_006214.2.87134 NP_006214.2.92137 ENSP00000394066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]