SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364012 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364012
Domain Number 1 Region: 93-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 291-445
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 8-109
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-21
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364012   Gene: ENSG00000131089   Transcript: ENST00000374878
Sequence length 478
Comment pep:known chromosome:GRCh38:X:63634967:63785533:-1 gene:ENSG00000131089 transcript:ENST00000374878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFV
RLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHL
KDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGP
CFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTP
VQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQA
SVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYY
KGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFRE
ERKMVQEDEKIGFEISENQKRQAAMTVRKLPFPQLSEARICSPKGFASVFNGTCCGES
Download sequence
Identical sequences ENSP00000364012 ENSP00000472113 ENSP00000364012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]