SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364298 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364298
Domain Number 1 Region: 208-339
Classification Level Classification E-value
Superfamily TPR-like 6.27e-28
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000271
Family FKBP immunophilin/proline isomerase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364298   Gene: ENSG00000204315   Transcript: ENST00000375156
Sequence length 349
Comment pep:known chromosome:GRCh38:6:32128707:32130291:-1 gene:ENSG00000204315 transcript:ENST00000375156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQIL
EHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
GSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGH
SGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
Download sequence
Identical sequences A0A024RCQ6 Q9UIM3
NP_071393.2.87134 NP_071393.2.92137 ENSP00000364298 ENSP00000397530 ENSP00000398812 ENSP00000364298 ENSP00000397530 ENSP00000398812 ENSP00000364298 ENSP00000397530 ENSP00000398812 9606.ENSP00000364298 9606.ENSP00000397530 9606.ENSP00000398812 399908 gi|17149853|ref|NP_071393.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]