SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364867 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364867
Domain Number 1 Region: 303-605
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.69e-73
Family Protein kinases, catalytic subunit 0.000000453
Further Details:      
 
Domain Number 2 Region: 140-262
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-35
Family Kringle modules 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSP00000364867
Domain Number - Region: 34-121
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00575
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364867   Gene: ENSG00000169071   Transcript: ENST00000375715
Sequence length 704
Comment pep:putative chromosome:GRCh38:9:91563091:91948880:-1 gene:ENSG00000169071 transcript:ENST00000375715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQG
EIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLE
SDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGS
GMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQ
NKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQ
RRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQ
TQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGD
LHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRN
VLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGV
VLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFK
DIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVVRMRGSGRQCWMTETPNAL
LWHNVSGVGSCRWVRGLADFKDEATDFRVMPRDPSLHCHVTSTA
Download sequence
Identical sequences B1APY4
ENSP00000364867 ENSP00000364867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]