SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364875 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364875
Domain Number 1 Region: 83-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 276-400
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-36
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 8-79
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-25
Family SH3-domain 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364875   Gene: ENSG00000102606   Transcript: ENST00000375723
Sequence length 625
Comment pep:novel chromosome:GRCh38:13:111205289:111295192:1 gene:ENSG00000102606 transcript:ENST00000375723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYV
REVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYL
RPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLK
ELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLG
NVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP
SHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPA
PPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDS
IWTAHSYRMGSTSRKSCCSYISHQN
Download sequence
Identical sequences ENSP00000364875 ENSP00000364875 XP_016876315.1.92137 XP_016876316.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]