SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364888 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364888
Domain Number 1 Region: 83-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 276-400
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-36
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 8-79
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-25
Family SH3-domain 0.0000378
Further Details:      
 
Weak hits

Sequence:  ENSP00000364888
Domain Number - Region: 582-638
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0157
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364888   Gene: ENSG00000102606   Transcript: ENST00000375736
Sequence length 646
Comment pep:known chromosome:GRCh38:13:111153738:111305731:1 gene:ENSG00000102606 transcript:ENST00000375736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYV
REVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYL
RPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMK
TLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLK
ELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLG
NVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLED
SENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP
SHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPA
PPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIE
AYCTSAKTRQTLNSSSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDE
VQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL
Download sequence
Identical sequences A0A024RDY9
gi|166064038|ref|NP_001106985.1| gi|4505573|ref|NP_003890.1| NP_001106985.1.87134 NP_001106985.1.92137 NP_001307780.1.87134 NP_001307780.1.92137 NP_003890.1.87134 NP_003890.1.92137 XP_016876313.1.92137 XP_016876314.1.92137 ENSP00000364888 ENSP00000397068 ENSP00000364888 ENSP00000397068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]