SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364891 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364891
Domain Number 1 Region: 211-412
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 404-528
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-36
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 136-207
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-25
Family SH3-domain 0.0000378
Further Details:      
 
Domain Number 4 Region: 2-96
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-17
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364891   Gene: ENSG00000102606   Transcript: ENST00000375739
Sequence length 753
Comment pep:known chromosome:GRCh38:13:111115277:111295195:1 gene:ENSG00000102606 transcript:ENST00000375739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKTFDAN
DLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLF
QGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRT
GWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKEL
QTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCF
LNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRL
DKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWE
GDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTG
MTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPH
SVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
SLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEED
AQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDL
SEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN
Download sequence
Identical sequences gi|166064036|ref|NP_001106984.1| NP_001106984.1.87134 NP_001106984.1.92137 ENSP00000364891 ENSP00000364891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]