SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000366025 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000366025
Domain Number - Region: 188-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000114
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 238-283
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0275
Family RILP dimerisation region 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366025   Gene: ENSG00000134874   Transcript: ENST00000376829
Sequence length 867
Comment pep:known chromosome:GRCh38:13:95581952:95644703:-1 gene:ENSG00000134874 transcript:ENST00000376829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQF
RPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKL
IRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRR
KKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSHFEYQKNAQIEKLR
SEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDE
MEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDF
HNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEE
LGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALH
TLETKSSLPMVHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKG
LRTMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEH
QVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVSTDRTSVPKIK
KNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPLPVPPPQNKGSFGKNTVKSD
ADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVPEMFIKKEELQ
ELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKG
EGLQENESSTLKSSLVTVTDWSDTSDV
Download sequence
Identical sequences Q86YF9
9606.ENSP00000257312 ENSP00000257312 ENSP00000366025 gi|39725957|ref|NP_945319.1| NP_945319.1.87134 NP_945319.1.92137 ENSP00000355018 ENSP00000257312 ENSP00000366025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]