SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366037 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366037
Domain Number 1 Region: 40-150
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-17
Family V set domains (antibody variable domain-like) 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSP00000366037
Domain Number - Region: 163-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000773
Family C1 set domains (antibody constant domain-like) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366037   Gene: ENSG00000165810   Transcript: ENST00000376841
Sequence length 344
Comment pep:known chromosome:GRCh38:5:181040225:181057169:1 gene:ENSG00000165810 transcript:ENST00000376841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLSVSPDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCH
LWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL
HSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSSGWYP
KPKVQWRDHQGQCLPPEFEAIVWDAQDLFSLETSVVVRAGALSNVSVSIQNLLLSQKKEL
VVQIADVFVPGASAWKSAFVATLPLLLVLAALALGVLRKQRRSREKLRKQAEKRQEKLTA
ELEKLQTELDWRRAEGQAECFVLASHPPGEGIQAASNSTTTLNA
Download sequence
Identical sequences ENSP00000366037 ENSP00000366037 NP_001295174.1.87134 NP_001295174.1.92137 XP_011532746.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]