SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366086 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366086
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Immunoglobulin 7.33e-22
Family V set domains (antibody variable domain-like) 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366086   Gene: ENSG00000204655   Transcript: ENST00000376889
Sequence length 142
Comment pep:known chromosome:GRCh38:6:29659319:29672372:1 gene:ENSG00000204655 transcript:ENST00000376889 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGD
QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEVSHS
VTQDWLQWHDHGSLQPPPPRLK
Download sequence
Identical sequences H0Y8A0
ENSP00000366086 ENSP00000418872 ENSP00000366086 ENSP00000418872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]