SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000366138 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366138
Domain Number 1 Region: 13-229
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-73
Family ALDH-like 0.00000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366138   Gene: ENSG00000165092   Transcript: ENST00000376939
Sequence length 230
Comment pep:known chromosome:GRCh38:9:72916969:72953056:-1 gene:ENSG00000165092 transcript:ENST00000376939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGASVV
Download sequence
Identical sequences A0A2I2ZI21 A0A2I3RJK8 Q5SYQ9
ENSP00000366138 ENSP00000366138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]