SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000366482 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366482
Domain Number 1 Region: 86-197
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366482   Gene: ENSG00000165060   Transcript: ENST00000377270
Sequence length 210
Comment pep:known chromosome:GRCh38:9:69035259:69074213:1 gene:ENSG00000165060 transcript:ENST00000377270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV
SLHELLAAELTKALKTKLDLSSLAYSGKDA
Download sequence
Identical sequences A0A0S2Z3G4 Q16595
HR6778 ENSP00000366482 gi|31077081|ref|NP_000135.2| ENSP00000366482 NP_000135.2.87134 NP_000135.2.92137 9606.ENSP00000366482 ENSP00000366482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]