SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367076 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367076
Domain Number 1 Region: 191-343
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.6e-37
Family 4HBT-like 0.00062
Further Details:      
 
Domain Number 2 Region: 28-172
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.74e-27
Family 4HBT-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367076   Gene: ENSG00000097021   Transcript: ENST00000377845
Sequence length 350
Comment pep:known chromosome:GRCh38:1:6264273:6360707:-1 gene:ENSG00000097021 transcript:ENST00000377845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLRRSLSLNVLRKEVDRACFGEKAKQIMRPDDANVAGNVHGGTILKMIEEAGAIISTR
HCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVNVMSENILTG
AKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGD
IVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNI
VTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFF
TYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP
Download sequence
Identical sequences A0A2I3HEL3 A0A2I3SZR6 A0A2J8URV1
ENSP00000367076 ENSP00000367076 gi|32528284|ref|NP_863655.1| NP_863655.1.87134 NP_863655.1.92137 XP_003281657.1.23891 XP_008973953.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]