SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000367624 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367624
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-51
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 188-334
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-18
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 341-401
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367624   Gene: ENSG00000130762   Transcript: ENST00000378373
Sequence length 421
Comment pep:putative chromosome:GRCh38:1:3466005:3481113:1 gene:ENSG00000130762 transcript:ENST00000378373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQ
RHKAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERR
PACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEG
AHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYL
FLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLL
RNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEV
TLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETD
V
Download sequence
Identical sequences ENSP00000367622 ENSP00000367624 ENSP00000367622 ENSP00000367624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]