SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368747 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368747
Domain Number 1 Region: 35-129
Classification Level Classification E-value
Superfamily Immunoglobulin 6.65e-21
Family V set domains (antibody variable domain-like) 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368747   Gene: ENSG00000205274   Transcript: ENST00000379435
Sequence length 130
Comment pep:known chromosome:GRCh38:9:33617762:33618506:1 gene:ENSG00000205274 transcript:ENST00000379435 gene_biotype:TR_V_gene transcript_biotype:TR_V_gene
Sequence
METVVTTLPREGGVGPSRKMLLLLLLLGPGSGLSAVVSQHPSRVICKSGTSVNIECRSLD
FQATTMFWYRQLRKQSLMLMATSNEGSEVTYEQGVKKDKFPINHPNLTFSALTVTSAHPE
DSSFYICSAR
Download sequence
Identical sequences A0A075B6H5
ENSP00000368747 ENSP00000368747 ENSP00000368747 9606.ENSP00000368747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]